Table 2 The physicochemical properties of the peptide. The extinction coefficient (EC) of 13,940 M− 1 cm− 1 indicates good water solubility and supports a quantitative study of protein-ligand and protein-protein interaction in solution
From: Potential antiviral peptides targeting the SARS-CoV-2 spike protein
Peptide Sequence | LENGTH | PI | GRAVY | MW (Da) | Solubility | Half-life (h) | Ii | Ai | EC (M−1 cm− 1) |
|---|---|---|---|---|---|---|---|---|---|
STIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNPTAWDLGKGDFRIL | 49 | 4.50 | −0.710 | 5713.23 | Good water solubility | 1.9 | 49.67 | 63.88 | 13,940 |